PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2238720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 430aa    MW: 47734.6 Da    PI: 6.7313
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2238720.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.83.7e-083533901954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +e+  LA++  L+++qV++WF N R +
  Lj5g3v2238720.1 353 FEHflHPYPNDSEKLMLASQSCLSKNQVSNWFINARVR 390
                      554459******************************88 PP

2BELL111.16.1e-36216286272
             BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      ++e+q k akL+sll+eV+ rY++y++q++ v+ssFe++ag+g+ak Yt+lAl+a+SrhF +L+dai++qi
  Lj5g3v2238720.1 216 KHEHQVKFAKLISLLDEVESRYEKYCHQMEEVVSSFEMIAGVGAAKCYTALALQAMSRHFCSLRDAIVSQI 286
                      79********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-31150284IPR006563POX domain
PfamPF075266.6E-39155283IPR006563POX domain
SMARTSM003897.7E-6334398IPR001356Homeobox domain
CDDcd000869.52E-10334395No hitNo description
Gene3DG3DSA:1.10.10.601.5E-24334407IPR009057Homeodomain-like
SuperFamilySSF466893.51E-16340402IPR009057Homeodomain-like
PfamPF059203.8E-15351390IPR008422Homeobox KN domain
PROSITE profilePS5007110.916353394IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MSNSINHENQ FGSQELVAYG SSLRNNNNNN SNAAFADTMG AFSSIQSIEG SEMSHTRHLM  60
DLLGAANQSN HHHQTQGLSL SLGSHMLVSP PPSDEYRHRP LNPGLMNPNY FMPQETTTDY  120
FFSGGNGGGG AFAPSSASLN RSPSTSYGAE SFAAVIGSSR YLKPAKSLLK DLVDVGGSVV  180
DRINEKLFHG SGAGARTLSL ELKAELRNNG HLLADKHEHQ VKFAKLISLL DEVESRYEKY  240
CHQMEEVVSS FEMIAGVGAA KCYTALALQA MSRHFCSLRD AIVSQINVEK RKLFQDLPKI  300
NGGISQLSLF DRDNRHSRMS LQHLGVIQSQ RHVWRPIRGL PETSVAILRS WLFEHFLHPY  360
PNDSEKLMLA SQSCLSKNQV SNWFINARVR LWKPMIEEMY KEEFGDSSED SNPPVNNCLA  420
MVEATDCVED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-15340398563Homeobox protein Meis2
4xrm_B6e-15340398563Homeobox protein Meis2
4xrs_A6e-15340397158Homeobox protein Meis1
4xrs_B6e-15340397158Homeobox protein Meis1
5bng_A6e-15340398159Homeobox protein Meis2
5bng_B6e-15340398159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523567.10.0PREDICTED: BEL1-like homeodomain protein 11 isoform X1
SwissprotQ1PFD11e-102BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLA0A0R0K2Y70.0A0A0R0K2Y7_SOYBN; Uncharacterized protein
STRINGGLYMA06G03210.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126452329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-104BEL1-like homeodomain 11